Proteintech, 67256-1-Ig, CDK9 Monoclonal antibody

Size: 20ul / 150ul The CDK9 (67256-1-Ig) by Proteintech is a Monoclonal antibody targeting CDK9 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67256-1-Ig targets CDK9 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, T-47D cells, HCT 116 cells, A431 cells, MOLT-4 cells, TF-1 cells, HSC-T6 cells, ROS1728 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29178 Product name: Recombinant human CDK9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-372 aa of BC001968 Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF Predict reactive species Full Name: cyclin-dependent kinase 9 Calculated Molecular Weight: 372 aa, 43 kDa Observed Molecular Weight: 38-42 kDa, 55 kDa GenBank Accession Number: BC001968 Gene Symbol: CDK9 Gene ID (NCBI): 1025 RRID: AB_3085038 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P50750 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.