Proteintech, 67283-1-Ig, ALG13 Monoclonal antibody

Size: 20ul / 150ul The ALG13 (67283-1-Ig) by Proteintech is a Monoclonal antibody targeting ALG13 in WB, ELISA applications with reactivity to human samples 67283-1-Ig targets ALG13 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14955 Product name: Recombinant human ALG13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-165 aa of BC005336 Sequence: MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK Predict reactive species Full Name: asparagine-linked glycosylation 13 homolog Calculated Molecular Weight: 1137 aa, 126 kDa Observed Molecular Weight: 130-135 kDa GenBank Accession Number: BC005336 Gene Symbol: ALG13 Gene ID (NCBI): 79868 RRID: AB_2882550 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NP73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.