Iright
BRAND / VENDOR: Proteintech

Proteintech, 67320-1-Ig, ARPC1B Monoclonal antibody

CATALOG NUMBER: 67320-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARPC1B (67320-1-Ig) by Proteintech is a Monoclonal antibody targeting ARPC1B in WB, IHC, ELISA applications with reactivity to Human, rat, mouse samples 67320-1-Ig targets ARPC1B in WB, IHC, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, THP-1 cells, rat spleen tissues Positive IHC detected in: human appendicitis tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information ARPC1B also known as ARC41, p41-ARC, or p40-ARC, is one of seven subunits of the human Arp2/3 protein complex, that belongs to the SOP2 family. ARPC1B localizes on centrosomes and has a distinct role in centrosomal homeostasis. ARPC1B is both a physiological activator and substrate of Aurora A kinase, and these interactions help to maintain mitotic integrity in mammalian cells. In recent resaeach, ARPC1B is selected as a candidate prediction marker for sensitivity of Choroidal malignant melanomas to radiotherapy. Specification Tested Reactivity: Human, rat, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29095 Product name: Recombinant human ARPC1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 265-372 aa of BC007555 Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK Predict reactive species Full Name: actin related protein 2/3 complex, subunit 1B, 41kDa Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC007555 Gene Symbol: ARPC1B Gene ID (NCBI): 10095 RRID: AB_2882580 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15143 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924