Iright
BRAND / VENDOR: Proteintech

Proteintech, 67335-1-Ig, RCC1 Monoclonal antibody

CATALOG NUMBER: 67335-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RCC1 (67335-1-Ig) by Proteintech is a Monoclonal antibody targeting RCC1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 67335-1-Ig targets RCC1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells, HepG2 cells, Jurkat cells, K-562 cells Positive IHC detected in: mouse brain tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information CHC1, also named as RCC1, promotes the exchange of ran-bound gdp by gtp. It is involved in the regulation of onset of chromosome condensation in the S-phase. Phosphorylation of RCC1 on serines located in or near its nuclear localization signal activates RCC1 to generate RanGTP on mitotic chromosomes, which is required for spindle assembly and chromosome segregation. Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17809 Product name: Recombinant human RCC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-421 aa of BC010067 Sequence: MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRVFLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPELFANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESCFIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSVACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQS Predict reactive species Full Name: regulator of chromosome condensation 1 Calculated Molecular Weight: 421 aa, 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC010067 Gene Symbol: RCC1 Gene ID (NCBI): 1104 RRID: AB_2882593 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P18754 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924