Iright
BRAND / VENDOR: Proteintech

Proteintech, 67342-1-Ig, TRIM2 Monoclonal antibody

CATALOG NUMBER: 67342-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIM2 (67342-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM2 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples 67342-1-Ig targets TRIM2 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples. Tested Applications Positive WB detected in: rat brain tissue, mouse cerebellum tissue, pig brain tissue Positive IHC detected in: mouse brain tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Tripartite motif-containing 2(TRIM2) is an E3 ubiquitin ligase which directs proteasome-mediated degradation of target proteins by the ubiquitination of NEFL and phosphorylation of BCL2L11. This protein contains an N-terminal RING domain, followed by a B-box-2 domain, a coiled-coil region, and 6 C-terminal NHL repeats. TRIM2 involves in the apoptotic response to ischemia via directing degradation of BIM protein, thus has a role in neuroprotection. Specification Tested Reactivity: Human, Mouse, Rat, Pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14637 Product name: Recombinant human TRIM2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC011052 Sequence: MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD Predict reactive species Full Name: tripartite motif-containing 2 Calculated Molecular Weight: 744 aa, 82 kDa Observed Molecular Weight: 70-85 kDa GenBank Accession Number: BC011052 Gene Symbol: TRIM2 Gene ID (NCBI): 23321 RRID: AB_2882600 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9C040 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924