Iright
BRAND / VENDOR: Proteintech

Proteintech, 67365-1-Ig, FBXO11 Monoclonal antibody

CATALOG NUMBER: 67365-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FBXO11 (67365-1-Ig) by Proteintech is a Monoclonal antibody targeting FBXO11 in WB, ELISA applications with reactivity to Human samples 67365-1-Ig targets FBXO11 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, U2OS cells, HeLa cells, HEK-293 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24401 Product name: Recombinant human FBXO11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 858-927 aa of BC012728 Sequence: TDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQHN Predict reactive species Full Name: F-box protein 11 Calculated Molecular Weight: 927 aa, 104 kDa Observed Molecular Weight: 94-104 kDa GenBank Accession Number: BC012728 Gene Symbol: FBXO11 Gene ID (NCBI): 80204 RRID: AB_2882617 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86XK2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924