Iright
BRAND / VENDOR: Proteintech

Proteintech, 67393-1-Ig, KEL Monoclonal antibody

CATALOG NUMBER: 67393-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KEL (67393-1-Ig) by Proteintech is a Monoclonal antibody targeting KEL in WB, ELISA applications with reactivity to Human samples 67393-1-Ig targets KEL in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human red blood cells Recommended dilution Western Blot (WB): WB : 1:3000-1:15000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28192 Product name: Recombinant human KEL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 70-311 aa of BC050639 Sequence: QNCGPRPCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQFYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQYGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQKIYAQIFREYLTYLNQLGTLLGGDPSKVQEHSSLSISITSRLFQFLRPLEQRRAQGKLFQMVTIDQLKEMA Predict reactive species Full Name: Kell blood group, metallo-endopeptidase Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 93 kDa GenBank Accession Number: BC050639 Gene Symbol: KEL Gene ID (NCBI): 3792 RRID: AB_2882637 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P23276 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924