Proteintech, 67397-1-Ig, SEMA7A Monoclonal antibody

Size: 20ul / 150ul The SEMA7A (67397-1-Ig) by Proteintech is a Monoclonal antibody targeting SEMA7A in WB, ELISA applications with reactivity to Human samples 67397-1-Ig targets SEMA7A in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human red blood cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:6000 Background Information SEMA7A, also named CD108 and SEMAL, belongs to the semaphorin family. SEMA7A is the only membrane‐associated glycosylphosphatidylinositol (GPI)‐linked semaphorin and plays a role in the regulation of neuronal axon outgrowth. In addition to its role in guiding axon pathfinding during neuronal development, Sema7A has diverse functions in morphogenesis and immune cell control and regulates T cell responses via the α1β1 integrin receptor (PMID: 31179640). SEMA7A has 2 isoforms with molecular weights of 73 and 75 kDa, respectively. Specification Tested Reactivity: Human Cited Reactivity: mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28804 Product name: Recombinant human SEMA7A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 371-423 aa of BC101643 Sequence: QPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGET Predict reactive species Full Name: semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) Calculated Molecular Weight: 666 aa, 75 kDa Observed Molecular Weight: 75-80 kDa GenBank Accession Number: BC101643 Gene Symbol: SEMA7A Gene ID (NCBI): 8482 RRID: AB_2882640 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75326 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.