Iright
BRAND / VENDOR: Proteintech

Proteintech, 67399-1-Ig, LACTB2 Monoclonal antibody

CATALOG NUMBER: 67399-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LACTB2 (67399-1-Ig) by Proteintech is a Monoclonal antibody targeting LACTB2 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 67399-1-Ig targets LACTB2 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, NIH/3T3 cells, HeLa cells, HEK-293 cells, Jurkat cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue, mouse liver tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10231 Product name: Recombinant human LACTB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-288 aa of BC000878 Sequence: MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL Predict reactive species Full Name: lactamase, beta 2 Calculated Molecular Weight: 288 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC000878 Gene Symbol: LACTB2 Gene ID (NCBI): 51110 RRID: AB_2882642 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q53H82 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924