Proteintech, 67404-1-Ig, VPS54 Monoclonal antibody

Size: 20ul / 150ul The VPS54 (67404-1-Ig) by Proteintech is a Monoclonal antibody targeting VPS54 in WB, IHC, ELISA applications with reactivity to Human, Pig, Mouse, Rat samples 67404-1-Ig targets VPS54 in WB, IHC, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, pig brain tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information VPS54 is a part of the Golgi-associated retrograde protein (GARP) complex protein required for tethering and fusion of endosome-derived transport vesicles to the trans-Golgi network. It may particpate in retrograde transport from early and late endosomes to the late Golgi. The GARP complex is required for the maintenance of the cycling of mannose 6-phosphate receptors between the TGN and endosomes, this cycling is necessary for proper lysosomal sorting of acid hydrolases such as CTSD. Specification Tested Reactivity: Human, Pig, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4123 Product name: Recombinant human VPS54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 746-965 aa of BC030275 Sequence: CVDNIPSVTTDMLTRLSDLLKYFNSRSCQLVLGAGALQVVGLKTITTKNLALSSRCLQLIVHYIPVIRAHFEARLPPKQYSMLRHFDHITKDYHDHIAEISAKLVAIMDSLFDKLLSKYEVKAPVPSACFRNICKQMTKMHEAIFDLLPEEQTQMLFLRINASYKLHLKKQLSHLNVINDGGPQNGLVTADVAFYTGNLQALKGLKDLDLNMAEIWEQKR Predict reactive species Full Name: vacuolar protein sorting 54 homolog (S. cerevisiae) Calculated Molecular Weight: 977 aa, 111 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC030275 Gene Symbol: VPS54 Gene ID (NCBI): 51542 RRID: AB_2882645 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9P1Q0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.