Proteintech, 67406-1-Ig, Secretogranin V Monoclonal antibody

Size: 20ul / 150ul The Secretogranin V (67406-1-Ig) by Proteintech is a Monoclonal antibody targeting Secretogranin V in IHC, ELISA applications with reactivity to Human samples 67406-1-Ig targets Secretogranin V in IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IHC detected in: human pituitary adenoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28607 Product name: Recombinant human SCG5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-212 aa of BC005349 Sequence: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLSDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE Predict reactive species Full Name: secretogranin V (7B2 protein) Calculated Molecular Weight: 24 kDa GenBank Accession Number: BC005349 Gene Symbol: Secretogranin V Gene ID (NCBI): 6447 RRID: AB_2882647 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P05408 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.