Proteintech, 67432-1-Ig, Podoplanin Monoclonal antibody

Size: 20ul / 150ul The Podoplanin (67432-1-Ig) by Proteintech is a Monoclonal antibody targeting Podoplanin in IHC, IF-P, FC, ELISA applications with reactivity to human samples 67432-1-Ig targets Podoplanin in WB, IHC, IF-P, FC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human appendicitis tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse small intestine tissue Positive FC detected in: MG-63 cells, A-253 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC): FC : 0.2 μg per 10^6 cells in a 100 µl suspension Background Information Podoplanin was identified as a glycoprotein found in the cell membranes of glomerular epithelial cells (podocyte) (PMID: 9327748). It is a lymphatic marker because the expression of podoplanin has been detected in lymphatic but not blood vascular endothelium, and is useful as the marker of tumor-associated Lymphangiogenesis. Podoplanin has a function in developing testis, most likely at the level of cell-cell interactions among pre-meiotic germ cells and immature Sertoli cells. It may be involved in cell migration and/or actin cytoskeleton organization. When expressed in keratinocytes, PDPN induces changes in cell morphology with transfected cells showing an elongated shape, numerous membrane protrusions, major reorganization of the actin cytoskeleton, increased motility and decreased cell adhesion. It is required for normal lung cell proliferation and alveolus formation at birth. PDPN induces platelet aggregation. It does not have any effect on folic acid or amino acid transport and does not function as a water channel or as a regulator of aquaporin-type water channels. The antibody is specific to Podoplanin. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17691 Product name: Recombinant human PDPN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 101-238 aa of BC022812 Sequence: TGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGGIIVVVMRKMSGRYSP Predict reactive species Full Name: podoplanin Calculated Molecular Weight: 238 aa, 25 kDa GenBank Accession Number: BC022812 Gene Symbol: Podoplanin Gene ID (NCBI): 10630 RRID: AB_2882670 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86YL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.