Iright
BRAND / VENDOR: Proteintech

Proteintech, 67440-1-Ig, PPM1D Monoclonal antibody

CATALOG NUMBER: 67440-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPM1D (67440-1-Ig) by Proteintech is a Monoclonal antibody targeting PPM1D in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples 67440-1-Ig targets PPM1D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples. Tested Applications Positive WB detected in: MCF-7 cells, HEK-293 cells, U2OS cells, pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PPM1D (also known as PP2Cd and WIP1) is a member of the PPM family, which is characterized by Mg2+/Mn2+-dependent activity and relative insensitivity to okadaic acid. The PPM1D gene is aberrantly amplified in a range of common cancers and encodes a protein phosphatase that is a potential therapeutic target (PMID: 17700519). This antibody can be detected two bands of 47 and 67 Kda. Specification Tested Reactivity: Human, Mouse, Rat, Pig Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24761 Product name: Recombinant human PPM1D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 254-423 aa of BC060877 Sequence: NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE Predict reactive species Full Name: protein phosphatase 1D magnesium-dependent, delta isoform Observed Molecular Weight: 67 kDa, 47 kDa GenBank Accession Number: BC060877 Gene Symbol: PPM1D Gene ID (NCBI): 8493 RRID: AB_2882676 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15297 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924