Proteintech, 67441-1-Ig, MESDC2 Monoclonal antibody

Size: 20ul / 150ul The MESDC2 (67441-1-Ig) by Proteintech is a Monoclonal antibody targeting MESDC2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 67441-1-Ig targets MESDC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: JAR cells, human placenta tissue, HeLa cells, A549 cells, Jurkat cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1403 Product name: Recombinant human MESDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC009210 Sequence: MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL Predict reactive species Full Name: mesoderm development candidate 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC009210 Gene Symbol: MESDC2 Gene ID (NCBI): 23184 RRID: AB_2882677 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14696 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.