Proteintech, 67449-1-Ig, OMA1 Monoclonal antibody

Size: 20ul / 150ul The OMA1 (67449-1-Ig) by Proteintech is a Monoclonal antibody targeting OMA1 in WB, ELISA applications with reactivity to Human, Mouse samples 67449-1-Ig targets OMA1 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HeLa cells, Jurkat cells, LNCaP cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information OMA1(Overlapping with the m-AAA protease 1 homolog) is also named as MPRP1(Metalloprotease-related protein 1) and belongs to the peptidase M48 family.It is a zinc metalloprotease that spans the inner mitochondrial membrane with a number of predicted membrane spanning domains and the 60 kDa form of OMA1 rapidly accumulated concomitantly with the cleavage of all OPA1 variants,and the 40 kDa form of OMA1 may be the inactive form, with the 60 kDa form being the active enzyme(PMID:20334834) Specification Tested Reactivity: Human, Mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11201 Product name: Recombinant human OMA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 361-524 aa of BC012915 Sequence: ICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACADIRASSVFWQQMEFVDSLHGQPKMPEWLSTHPSHGNRVEYLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS Predict reactive species Full Name: OMA1 homolog, zinc metallopeptidase (S. cerevisiae) Calculated Molecular Weight: 524 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC012915 Gene Symbol: OMA1 Gene ID (NCBI): 115209 RRID: AB_2882683 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96E52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.