Proteintech, 67458-1-Ig, AXIN2 Monoclonal antibody

Size: 20ul / 150ul The AXIN2 (67458-1-Ig) by Proteintech is a Monoclonal antibody targeting AXIN2 in WB, ELISA applications with reactivity to human, rat samples 67458-1-Ig targets AXIN2 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, HepG2 cells, Jurkat cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:9600 Background Information Axis inhibition protein2 (AXIN2), also known as Coductin or Axil, is a multidomain scaffold protein that negatively regulate Wnt signaling. AXIN2 can directly interact with beta-catenin and GSK3B. AXIN2 has a number of phosphorylation sites, and also can undergo poly(ADP-ribosy)lation by tankyrase TNKS and TNKS2. Poly(ADP-ribosy)lated AXIN2 then get unbiquitinated by RNF146 and leads to its degradation and subsequent activation of Wnt signaling. AXIN2 is localized in the cytoplasm and its mutation is involved in colorectal cancer. Specification Tested Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29291 Product name: Recombinant human AXIN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-83 aa of BC006295 Sequence: EGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLH Predict reactive species Full Name: axin 2 Calculated Molecular Weight: 843 aa, 94 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC006295 Gene Symbol: AXIN2 Gene ID (NCBI): 8313 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y2T1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.