Iright
BRAND / VENDOR: Proteintech

Proteintech, 67464-1-Ig, C20orf3/APMAP Monoclonal antibody

CATALOG NUMBER: 67464-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C20orf3/APMAP (67464-1-Ig) by Proteintech is a Monoclonal antibody targeting C20orf3/APMAP in WB, IHC, ELISA applications with reactivity to human, mouse, rat, rabbit samples 67464-1-Ig targets C20orf3/APMAP in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: Jurkat cells, HSC-T6 cells, rabbit liver tissue, HepG2 cells, LNCaP cells, NIH/3T3 cells, human placenta tissue, mouse liver tissue, rat liver tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29996 Product name: Recombinant human C20orf3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 66-416 aa of BC003501 Sequence: DPQPLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLLSSETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMSTIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYLGSFRSPFLCRLSLQAV Predict reactive species Full Name: chromosome 20 open reading frame 3 Calculated Molecular Weight: 416 aa, 46 kDa Observed Molecular Weight: 42-46 kDa GenBank Accession Number: BC003501 Gene Symbol: APMAP Gene ID (NCBI): 57136 RRID: AB_2882693 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9HDC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924