Iright
BRAND / VENDOR: Proteintech

Proteintech, 67490-1-Ig, UNG Monoclonal antibody

CATALOG NUMBER: 67490-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UNG (67490-1-Ig) by Proteintech is a Monoclonal antibody targeting UNG in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67490-1-Ig targets UNG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, LNCaP cells, HT-29 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human liver cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29979 Product name: Recombinant human UNG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-304 aa of BC015205 Sequence: MGVFCLGPWGLGRKLRTPGKGPLQLLSRLCGDHLQAIPAKKAPAGQEEPGTPPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL Predict reactive species Full Name: uracil-DNA glycosylase Calculated Molecular Weight: 304 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC015205 Gene Symbol: UNG Gene ID (NCBI): 7374 RRID: AB_2918492 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P13051 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924