Iright
BRAND / VENDOR: Proteintech

Proteintech, 67491-1-Ig, PRKACA Monoclonal antibody

CATALOG NUMBER: 67491-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRKACA (67491-1-Ig) by Proteintech is a Monoclonal antibody targeting PRKACA in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 67491-1-Ig targets PRKACA in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: PC-3 cells, HeLa cells, LNCaP cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, Pig liver tissue Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information PRKACA, also named as PKACA and PKA C-alpha, belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family and cAMP subfamily. It phosphorylates a large number of substrates in the cytoplasm and the nucleus. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26400 Product name: Recombinant human PRKACA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-351 aa of BC039846 Sequence: DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF Predict reactive species Full Name: protein kinase, cAMP-dependent, catalytic, alpha Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 38-43 kDa GenBank Accession Number: BC039846 Gene Symbol: PRKACA Gene ID (NCBI): 5566 RRID: AB_2882716 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17612 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924