Iright
BRAND / VENDOR: Proteintech

Proteintech, 67498-1-Ig, AKR1B1 Monoclonal antibody

CATALOG NUMBER: 67498-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AKR1B1 (67498-1-Ig) by Proteintech is a Monoclonal antibody targeting AKR1B1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 67498-1-Ig targets AKR1B1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7571 Product name: Recombinant human AKR1B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-316 aa of BC000260 Sequence: MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF Predict reactive species Full Name: aldo-keto reductase family 1, member B1 (aldose reductase) Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC000260 Gene Symbol: AKR1B1 Gene ID (NCBI): 231 RRID: AB_2882722 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P15121 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924