Iright
BRAND / VENDOR: Proteintech

Proteintech, 67516-1-Ig, PIR Monoclonal antibody

CATALOG NUMBER: 67516-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PIR (67516-1-Ig) by Proteintech is a Monoclonal antibody targeting PIR in WB, ELISA applications with reactivity to Human, mouse, rat samples 67516-1-Ig targets PIR in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, HeLa cells, K-562 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Pirin (iron-binding nuclear protein, PIR) is a highly conserved 32-kDa protein consisting of 290 amino acids. Pirin mRNA is expressed weakly in all human tissues. Confocal immunofluorescence experiments demonstrate a predominant localization of Pirin within dot-like subnuclear structures. Pirin interacts with the oncoprotein B-cell lymphoma 3-encoded (Bcl-3) and nuclear factor I (NFI). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29969 Product name: Recombinant human PIR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 46-230 aa of BC002517 Sequence: KGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVEN Predict reactive species Full Name: pirin (iron-binding nuclear protein) Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC002517 Gene Symbol: PIR Gene ID (NCBI): 8544 RRID: AB_2882737 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924