Iright
BRAND / VENDOR: Proteintech

Proteintech, 67521-1-Ig, RB1 Monoclonal antibody

CATALOG NUMBER: 67521-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RB1 (67521-1-Ig) by Proteintech is a Monoclonal antibody targeting RB1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 67521-1-Ig targets RB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HL-60 cells, K-562 cells, MCF-7 cells, TF-1 cells Positive IHC detected in: Insulinoma tissue, rat eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RB1, also named as pp110, pRb and p105 Rb, belongs to the retinoblastoma protein (RB) family. It is a key regulator of entry into cell division that acts as a tumor suppressor. RB1 acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. It is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. It recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. RB1 controls histone H4 'Lys-20' trimethylation and inhibits the intrinsic kinase activity of TAF1. It mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. In case of viral infections, interactions with SV40 large T antigen, HPV E7 protein or adenovirus E1A protein induce the disassembly of RB1-E2F1 complex thereby disrupting RB1's activity. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22578 Product name: Recombinant human RB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 373-581 aa of BC039060 Sequence: TPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREG Predict reactive species Full Name: retinoblastoma 1 Calculated Molecular Weight: 928 aa, 106 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC039060 Gene Symbol: RB1 Gene ID (NCBI): 5925 RRID: AB_2882741 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P06400 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924