Iright
BRAND / VENDOR: Proteintech

Proteintech, 67531-1-Ig, GPT/ALT1 Monoclonal antibody

CATALOG NUMBER: 67531-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPT/ALT1 (67531-1-Ig) by Proteintech is a Monoclonal antibody targeting GPT/ALT1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67531-1-Ig targets GPT/ALT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human milk, pig heart tissue, pig liver tissue, rat liver tissue, mouse liver tissue, rabbit heart tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GPT, also known as ALT1 (glutamate-pyruvate transaminase 1), catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10453 Product name: Recombinant human GPT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 147-496 aa of BC018207 Sequence: IPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFHAKFTLEYS Predict reactive species Full Name: glutamic-pyruvate transaminase (alanine aminotransferase) Calculated Molecular Weight: 496 aa, 55 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC018207 Gene Symbol: ALT1 Gene ID (NCBI): 2875 RRID: AB_2882750 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P24298 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924