Iright
BRAND / VENDOR: Proteintech

Proteintech, 67533-1-Ig, MYL4 Monoclonal antibody

CATALOG NUMBER: 67533-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MYL4 (67533-1-Ig) by Proteintech is a Monoclonal antibody targeting MYL4 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 67533-1-Ig targets MYL4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig heart tissue, K-562 cells, Mo7e cells, TF-1 cells, rat heart tissues, mouse heart tissues Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Positive FC (Intra) detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Myosin light‐chain 4 (MYL4) encodes an essential myosin light chain that is expressed in embryonic whole heart and skeletal muscle. It is specifically expressed in human atria after birth. MYL4 is essential for atrial electrical, functional, and structural integrity, and MYL4 dysfunction can produce severe inherited atrial cardiomyopathy. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19244 Product name: Recombinant human MYL4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC030228 Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG Predict reactive species Full Name: myosin, light chain 4, alkali; atrial, embryonic Calculated Molecular Weight: 197 aa, 22 kDa Observed Molecular Weight: 22-25 kDa GenBank Accession Number: BC030228 Gene Symbol: MYL4 Gene ID (NCBI): 4635 RRID: AB_2882752 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P12829 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924