Iright
BRAND / VENDOR: Proteintech

Proteintech, 67534-1-Ig, RALYL Monoclonal antibody

CATALOG NUMBER: 67534-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RALYL (67534-1-Ig) by Proteintech is a Monoclonal antibody targeting RALYL in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67534-1-Ig targets RALYL in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, HEK-293 cells, HeLa cells, mouse brain tissue, rat brain tissue, LNCaP cells, IMR-32 cells, Daudi cells, NK-92 cells, HepG2 cells, Raji cells, rabbit brain tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11676 Product name: Recombinant human RALYL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-291 aa of BC031090 Sequence: MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFVQYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLSVGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK Predict reactive species Full Name: RALY RNA binding protein-like Calculated Molecular Weight: 291 aa, 32 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC031090 Gene Symbol: RALYL Gene ID (NCBI): 138046 RRID: AB_2882753 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q86SE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924