Iright
BRAND / VENDOR: Proteintech

Proteintech, 67572-1-Ig, HSD3B2 Monoclonal antibody

CATALOG NUMBER: 67572-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSD3B2 (67572-1-Ig) by Proteintech is a Monoclonal antibody targeting HSD3B2 in WB, IF/ICC, ELISA applications with reactivity to human, pig samples 67572-1-Ig targets HSD3B2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: human placenta tissue, pig adrenal gland tissue, human adrenal gland tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information HSD3B2(3-beta-hydroxy-Delta(5)-steroid dehydrogenase) belongs to the 3-beta-HSD family and catalyzes the oxidation and isomerization of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, thus leading to the formation of all classes of steroid hormones.HSD3B2 is expressed almost exclusively in adrenals and gonads, whereas HSD3B1 is expressed predominantly in the placenta and skin(PMID:1682237). Defects in HSD3B2 are the cause of adrenal hyperplasia type 2 (AH2). Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4291 Product name: Recombinant human HSD3B2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-286 aa of BC038419 Sequence: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP Predict reactive species Full Name: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC038419 Gene Symbol: HSD3B2 Gene ID (NCBI): 3284 RRID: AB_2882785 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P26439 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924