Proteintech, 67586-1-Ig, ATM Monoclonal antibody

Size: 20ul / 150ul The ATM (67586-1-Ig) by Proteintech is a Monoclonal antibody targeting ATM in WB, ELISA applications with reactivity to human, rat samples 67586-1-Ig targets ATM in WB, IF, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control. Specification Tested Reactivity: human, rat Cited Reactivity: human, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30001 Product name: Recombinant human ATM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1059-1361 aa of BC137169 Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG Predict reactive species Full Name: ataxia telangiectasia mutated Observed Molecular Weight: 310-350 kDa GenBank Accession Number: BC137169 Gene Symbol: ATM Gene ID (NCBI): 472 RRID: AB_2882795 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13315 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.