Iright
BRAND / VENDOR: Proteintech

Proteintech, 67626-1-Ig, VSX2 Monoclonal antibody

CATALOG NUMBER: 67626-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VSX2 (67626-1-Ig) by Proteintech is a Monoclonal antibody targeting VSX2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 67626-1-Ig targets VSX2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, rat eye tissue, Ramos cells, Daudi cells, NCCIT cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information VSX2, also named as CHX10 and HOX10, belongs to the paired homeobox family. VSX2 plays a significant role in the specification and morphogenesis of the sensory retina. It may also participate in the development of the cells of the inner nuclear layer, particularly bipolar cells. Defects in VSX2 are the cause of microphthalmia isolated type 2 (MCOP2). Defects in VSX2 are the cause of microphthalmia with cataracts and iris abnormalities (MCOPCTI). Defects in VSX2 are the cause of microphthalmia isolated with coloboma type 3 (MCOPCB3). The antibody is specific to VSX2. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29867 Product name: Recombinant human VSX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-147 aa of BC128153 Sequence: MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRK Predict reactive species Full Name: visual system homeobox 2 Calculated Molecular Weight: 361 aa, 39 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC128153 Gene Symbol: VSX2 Gene ID (NCBI): 338917 RRID: AB_2882827 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P58304 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924