Proteintech, 67635-1-Ig, SLC25A17 Monoclonal antibody

Size: 20ul / 150ul The SLC25A17 (67635-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC25A17 in WB, IHC, ELISA applications with reactivity to human, mouse samples 67635-1-Ig targets SLC25A17 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, U2OS cells, A549 cells, HeLa cells, HepG2 cells, K-562 cells, Jurkat cells Positive IHC detected in: human liver cancer tissue, human liver tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information SLC25A17 (solute carrier family 25 member 17), is a kind of peroxisomal transporter for multiple cofactors such as CoA, FAD, FMN and AMP. It May catalyze the transport of free CoA, FAD and NAD+ from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. SLC25A17 is the only member of the mitochondrial carrier family localized to peroxisomal. (PMID: 22185573, 32266253) Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24456 Product name: Recombinant human SLC25A17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 34-104 aa of BC012998 Sequence: RLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKD Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17 Calculated Molecular Weight: 307 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC012998 Gene Symbol: SLC25A17 Gene ID (NCBI): 10478 RRID: AB_2882836 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O43808 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.