Iright
BRAND / VENDOR: Proteintech

Proteintech, 67641-1-Ig, BAT1 Monoclonal antibody

CATALOG NUMBER: 67641-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BAT1 (67641-1-Ig) by Proteintech is a Monoclonal antibody targeting BAT1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 67641-1-Ig targets BAT1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells, 4T1 cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information DDX39B, is a 428 amino acid protein, which contains one helicase C-terminal domain, one helicase ATP-binding domain and belongs to the DEAD box helicase family. DECD subfamily. DDX39B localizes in the nucleus and cytoplasm. BAT1 is involved in nuclear export of spliced and unspliced mRNA. BAT1 as ATP dependent RNA helicase, may be a translation initiation factor and acts as a negative regulator of inflammatory cytokines. This antibody may cross-react with DDX39A. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6612 Product name: Recombinant human BAT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 80-428 aa of BC000361 Sequence: ILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR Predict reactive species Full Name: HLA-B associated transcript 1 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC000361 Gene Symbol: BAT1 Gene ID (NCBI): 7919 RRID: AB_2882841 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13838 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924