Iright
BRAND / VENDOR: Proteintech

Proteintech, 67688-1-Ig, ESYT1 Monoclonal antibody

CATALOG NUMBER: 67688-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ESYT1 (67688-1-Ig) by Proteintech is a Monoclonal antibody targeting ESYT1 in WB, IF/ICC, ELISA applications with reactivity to human, rat samples 67688-1-Ig targets ESYT1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HEK-293T cells, HSC-T6 cells, MOLT-4 cells, Jurkat cells, K-562 cells, THP-1 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16840 Product name: Recombinant human FAM62A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 755-1104 aa of BC004998 Sequence: DVPSGRLHLRLERLTPRPTAAELEEVLQVNSLIQTQKSAELAAALLSIYMERAEDLPLRKGTKHLSPYATLTVGDSSHKTKTISQTSAPVWDESASFLIRKPHTESLELQVRGEGTGVLGSLSLPLSELLVADQLCLDRWFTLSSGQGQVLLRAQLGILVSQHSGVEAHSHSYSHSSSSLSEEPELSGGPPHITSSAPELRQRLTHVDSPLEAPAGPLGQVKLTLWYYSEERKLVSIVHGCRSLRQNGRDPPDPYVSLLLLPDKNRGTKRRTSQKKRTLSPEFNERFEWELPLDEAQRRKLDVSVKSNSSFMSRERELLGKVQLDLAETDLSQGVARWYDLMDNKDKGSS Predict reactive species Full Name: family with sequence similarity 62 (C2 domain containing), member A Calculated Molecular Weight: 1104 aa, 123 kDa Observed Molecular Weight: 123 kDa GenBank Accession Number: BC004998 Gene Symbol: ESYT1 Gene ID (NCBI): 23344 RRID: AB_2882881 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BSJ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924