Proteintech, 67703-1-Ig, ITK Monoclonal antibody

Size: 20ul / 150ul The ITK (67703-1-Ig) by Proteintech is a Monoclonal antibody targeting ITK in WB, IF/ICC, ELISA applications with reactivity to Human samples 67703-1-Ig targets ITK in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Jurkat cells, PBMC cells Positive IF/ICC detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ITK is a member of Tec family (BTK, ITK, Tec, BMX and RLK), which expressed in normal T-lymphocytes and T-cell associated hematopoietic malignancies and have confirmed its critical role in regulating T lymphocyte function in EBV-driven lymphoproliferative disease and immune-mediated disorders. Tec kinase family members shares similarities structure, consisting of PH domain, SH3 domain, SH2 domain and kinase domain. Loss of function mutations in ITK results in hypogammaglobulinemia and CD4+ T cell loss in humans, and the patients often present with EBV-associated B cell lymphoproliferative syndrome (PMID: 30814910, PMID: 31025232). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17087 Product name: Recombinant human ITK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 151-258 aa of BC109077 Sequence: NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK Predict reactive species Full Name: IL2-inducible T-cell kinase Calculated Molecular Weight: 620 aa, 72 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC109077 Gene Symbol: ITK Gene ID (NCBI): 3702 RRID: AB_2882895 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08881 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.