Proteintech, 67710-1-Ig, TNC/Tenascin-C Monoclonal antibody

Size: 20ul / 150ul The TNC/Tenascin-C (67710-1-Ig) by Proteintech is a Monoclonal antibody targeting TNC/Tenascin-C in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat samples 67710-1-Ig targets TNC/Tenascin-C in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: rat brain tissue, HEK-293 cells, rat cerebellum tissue, mouse brain tissue Positive IHC detected in: human breast cancer tissue, human liver cancer tissue, human lung cancer tissue, mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation. Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21412 Product name: Recombinant human TNC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1852-2201 aa of BC151843 Sequence: YALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA Predict reactive species Full Name: tenascin C Calculated Molecular Weight: 2201 aa, 241 kDa Observed Molecular Weight: 260 kDa GenBank Accession Number: BC151843 Gene Symbol: Tenascin C Gene ID (NCBI): 3371 RRID: AB_2882900 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P24821 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.