Proteintech, 67725-1-Ig, WWOX Monoclonal antibody

Size: 20ul / 150ul The WWOX (67725-1-Ig) by Proteintech is a Monoclonal antibody targeting WWOX in WB, IHC, ELISA applications with reactivity to Human, rat, pig, mouse samples 67725-1-Ig targets WWOX in WB, IHC, ELISA applications and shows reactivity with Human, rat, pig, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, pig liver tissue, rat liver tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information WWOX(WW domain-containing oxidoreductase) is also named as FOR, WOX1 and belongs to the short-chain dehydrogenases/reductases (SDR) family. The gene encodes a 46 kDa protein that contains two WW domains and a short-chain dehydrogenase/reductase domain and the protein is lost or reduced in the majority of many cancer types including breast, prostate, esophageal, lung, stomach, and pancreatic carcinomas and in a large fraction of other cancer types(PMID:17360458). WWOX behaves as a potential tumor-suppressor gene(PMID:15064722). It has 7 isoforms produced by alternative splicing. Specification Tested Reactivity: Human, rat, pig, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7969 Product name: Recombinant human WWOX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-234 aa of BC003184 Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG Predict reactive species Full Name: WW domain containing oxidoreductase Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC003184 Gene Symbol: WWOX Gene ID (NCBI): 51741 RRID: AB_2882911 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NZC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.