Iright
BRAND / VENDOR: Proteintech

Proteintech, 67730-1-Ig, ZNF217 Monoclonal antibody

CATALOG NUMBER: 67730-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF217 (67730-1-Ig) by Proteintech is a Monoclonal antibody targeting ZNF217 in WB, IHC, ELISA applications with reactivity to human, mouse samples 67730-1-Ig targets ZNF217 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, 4T1 cells, HEK-293 cells, MCF-7 cells, HepG2 cells, PC-3 cells, K-562 cells Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19468 Product name: Recombinant human ZNF217 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 707-1043 aa of BC113427 Sequence: IPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRP Predict reactive species Full Name: zinc finger protein 217 Calculated Molecular Weight: 1048 aa, 115 kDa Observed Molecular Weight: 110-130 kDa GenBank Accession Number: BC113427 Gene Symbol: ZNF217 Gene ID (NCBI): 7764 RRID: AB_2882916 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75362 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924