Proteintech, 67742-1-Ig, ACADM Monoclonal antibody

Size: 20ul / 150ul The ACADM (67742-1-Ig) by Proteintech is a Monoclonal antibody targeting ACADM in WB, IHC, IF-P, ELISA applications with reactivity to human, rat, pig samples 67742-1-Ig targets ACADM in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat, pig samples. Tested Applications Positive WB detected in: PC-3 cells, HSC-T6 cells, rat liver tissue, HeLa cells, HEK-293 cells, HepG2 cells Positive IHC detected in: human liver tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information ACADM, also named as MCAD, belongs to the acyl-CoA dehydrogenase family. This enzyme is specific for acyl chain lengths of 4 to 16. It catalyzes the reaction: Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor. Defects in ACADM are the cause of medium-chain acyl-CoA dehydrogenase deficiency (MCAD deficiency). This protein can exsit as a dimer(PMID:8962055). This antibody is specific to ACADM. Specification Tested Reactivity: human, rat, pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30620 Product name: Recombinant human ACADM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 205-352 aa of BC005377 Sequence: ARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTY Predict reactive species Full Name: acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain Calculated Molecular Weight: 421 aa, 47 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC005377 Gene Symbol: ACADM Gene ID (NCBI): 34 RRID: AB_2918511 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P11310 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.