Proteintech, 67746-1-Ig, USP14 Monoclonal antibody

Size: 20ul / 150ul The USP14 (67746-1-Ig) by Proteintech is a Monoclonal antibody targeting USP14 in WB, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit samples 67746-1-Ig targets USP14 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, U2OS cells, K-562 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information USP14(Ubiquitin carboxyl-terminal hydrolase 14) is also named as TGT and belongs to the peptidase C19 family. Mammalian USP14 is unique among known UBP enzymes in that it is activated catalytically upon specific association with the 26S proteasome. USP14 inhibition accelerated the degradation of oxidized proteins and enhanced resistance to oxidative stress. Specification Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6312 Product name: Recombinant human USP14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-294 aa of BC003556 Sequence: MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRL Predict reactive species Full Name: ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC003556 Gene Symbol: USP14 Gene ID (NCBI): 9097 RRID: AB_2918515 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P54578 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.