Product Description
Size: 20ul / 150ul
The GPX4 (67763-1-Ig) by Proteintech is a Monoclonal antibody targeting GPX4 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples
67763-1-Ig targets GPX4 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster samples.
Tested Applications
Positive WB detected in: EC109 cells, HEK-293 cells, NCCIT cells, pig brain tissue, rabbit testis tissue, Hela cells, HepG2 cells, Jurkat cells, HSC-T6 cells, 4T1 cells, ATDC-5 cells, MDCK cells, CHO cells, Chicken brain tissue, Zebrafish tissue, human platelet tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, rat testis tisssue, mouse testis tissue
Positive IHC detected in: human liver cancer tissue, mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse testis tissue
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600
Background Information
GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.
Specification
Tested Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, zebrafish, hamster
Cited Reactivity: human, mouse, rat, pig, rabbit, chicken, bovine, sheep, goat, duck
Host / Isotype: Mouse / IgG2b
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species
Full Name: glutathione peroxidase 4 (phospholipid hydroperoxidase)
Observed Molecular Weight: 20-23 kDa
GenBank Accession Number: BC021567
Gene Symbol: GPX4
Gene ID (NCBI): 2879
RRID: AB_2909469
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P36969
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924