Proteintech, 67770-1-Ig, PSMD2 Monoclonal antibody

Size: 20ul / 150ul The PSMD2 (67770-1-Ig) by Proteintech is a Monoclonal antibody targeting PSMD2 in WB, ELISA applications with reactivity to human, mouse, rat samples 67770-1-Ig targets PSMD2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Background Information Tumor necrosis factor type 1 receptor-associated protein 2 (TRAP2), encoded by PSMD2 gene, is a non-ATPase regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. TRAP2 may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6543 Product name: Recombinant human PSMD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 561-908 aa of BC002368 Sequence: GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 2 Calculated Molecular Weight: 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC002368 Gene Symbol: PSMD2 Gene ID (NCBI): 5708 RRID: AB_2918536 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13200 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.