Iright
BRAND / VENDOR: Proteintech

Proteintech, 67783-1-Ig, PPP2R2A/B/C Monoclonal antibody

CATALOG NUMBER: 67783-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP2R2A/B/C (67783-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP2R2A/B/C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67783-1-Ig targets PPP2R2A/B/C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: HepG2 cells, pig brain tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The PPP2R2B gene encodes a deduced 443 amino acid protein of approximately 52 kDa, which is a brain-specific regulatory subunit B of protein phosphatase 2. PPP2R2B is a Subunit of PP2A, a highly conserved constitutive enzyme(PMID:11719278). PPP2R2B (Bβ) is an important regulator of protein phosphatase 2A (PP2A) activity in the brain. Through differential promoter usage and alternative splicing, two major isoforms Bβ1 and Bβ2 with divergent sub-cellular targeting N termini are produced. Bβ plays an important role in neuronal survival. It has 5 isoforms produced by alternative splicing. This antibody can recognize PPP2R2A and PPP2R2C due to the immunogen of PPP2R2B having high homology with PPP2R2A and PPP2R2C. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30774 Product name: Recombinant human PPP2R2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 290-443 aa of BC031790 Sequence: SHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAWHPSENIIAVAATNNLYIFQDKVN Predict reactive species Full Name: protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform Calculated Molecular Weight: 443 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC031790 Gene Symbol: PPP2R2B Gene ID (NCBI): 5521 RRID: AB_2918547 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q00005 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924