Iright
BRAND / VENDOR: Proteintech

Proteintech, 67791-1-Ig, AIF Monoclonal antibody

CATALOG NUMBER: 67791-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AIF (67791-1-Ig) by Proteintech is a Monoclonal antibody targeting AIF in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, canine samples 67791-1-Ig targets AIF in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, canine samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH-3T3 cells, MDCK cells, Pig brain cells Positive IHC detected in: human kidney tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human kidney tissue Positive IF/ICC detected in: HeLa cells, HCT 116 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Apoptosis-inducing factor (AIF) is one of the mitochondrial proteins to be released into the cytosol during apoptosis, and it is discovered as the first protein that regulates caspase-independent apoptosis(PMID:20494118). AIF is encoded as a 67 kDa protein that contains a mitochondrial localization signal (MLS) in the N-terminus.It is cleaved from the 62 kDa to the 57 kDa form following ischemic injury and translocated from the mitochondria to the nucleus in a calpain-dependent manner(PMID:19332058). Specification Tested Reactivity: human, mouse, rat, pig, canine Cited Reactivity: human, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12400 Product name: Recombinant human AIF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 259-609 aa of BC111065 Sequence: TPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED Predict reactive species Full Name: apoptosis-inducing factor, mitochondrion-associated, 1 Calculated Molecular Weight: 609 aa, 66 kDa Observed Molecular Weight: 67 kDa, 57 kDa GenBank Accession Number: BC111065 Gene Symbol: AIF Gene ID (NCBI): 9131 RRID: AB_2918555 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95831 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924