Proteintech, 67795-1-Ig, RP2 Monoclonal antibody

Size: 20ul / 150ul The RP2 (67795-1-Ig) by Proteintech is a Monoclonal antibody targeting RP2 in WB, ELISA applications with reactivity to Human, rabbit samples 67795-1-Ig targets RP2 in WB, ELISA applications and shows reactivity with Human, rabbit samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, Y79 cells, Jurkat cells, human platelets tissue, human placenta tissue, rabbit retina tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: Human, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5630 Product name: Recombinant human RP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC043348 Sequence: MGCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI Predict reactive species Full Name: retinitis pigmentosa 2 (X-linked recessive) Calculated Molecular Weight: 350 aa, 40 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC043348 Gene Symbol: RP2 Gene ID (NCBI): 6102 RRID: AB_2918559 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75695 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.