Proteintech, 67797-1-Ig, MFG-E8 Monoclonal antibody

Size: 20ul / 150ul The MFG-E8 (67797-1-Ig) by Proteintech is a Monoclonal antibody targeting MFG-E8 in WB, IHC, ELISA applications with reactivity to Human samples 67797-1-Ig targets MFG-E8 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: human milk, human placenta tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Background Information Milk fat globule-epidermal growth factor-factor 8 (MFG-E8), also known as lactadherin, is a multifunctional secreted glycoprotein exhibiting versatile functions in cell physiology affecting health and diseases. It plays roles in clearance of apoptotic cells, anti-inflammatory, wound healing, arterial remodeling, angiogenesis, enhancing tumorigenicity and cancer metastasis (PMID: 23972256). MFG-E8 consists of two-repeated EGF-likedomains, a mucin-like domain and two-repeated discoidin-like domains (C-domains), and contains an integrin-binding motif (RGD sequence) in the EGF-like domain (PMID: 11856354). It shows ubiquitous pattern of expression in various types of cells and tissues. Altered expression of MFG-E8 causes disruptions of homeostasis and is correlated with a number of diseases (PMID: 27429513). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30666 Product name: Recombinant human MFGE8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-335 aa of BC003610 Sequence: LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC Predict reactive species Full Name: milk fat globule-EGF factor 8 protein Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC003610 Gene Symbol: MFGE8 Gene ID (NCBI): 4240 RRID: AB_2918561 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.