Iright
BRAND / VENDOR: Proteintech

Proteintech, 67798-1-Ig, CNOT4 Monoclonal antibody

CATALOG NUMBER: 67798-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CNOT4 (67798-1-Ig) by Proteintech is a Monoclonal antibody targeting CNOT4 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67798-1-Ig targets CNOT4 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells. Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information CNOT4, also known as CCR4-NOT transcription complex subunit 4 , has E3 ubiquitin ligase activity, and promotes ubiquitination and degradation of target proteins. CNOT4 is involved in activation of the JAK/STAT pathway. CNOT4 exist many isoforms and the range of its molecular weight from 48 to 84 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29964 Product name: Recombinant human CNOT4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 273-572 aa of BC035590 Sequence: IDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA Predict reactive species Full Name: CCR4-NOT transcription complex, subunit 4 Calculated Molecular Weight: 575 aa, 64 kDa Observed Molecular Weight: 64-85 kDa GenBank Accession Number: BC035590 Gene Symbol: CNOT4 Gene ID (NCBI): 4850 RRID: AB_2918562 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95628 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924