Proteintech, 67806-1-Ig, PKMYT1 Monoclonal antibody

Size: 20ul / 150ul The PKMYT1 (67806-1-Ig) by Proteintech is a Monoclonal antibody targeting PKMYT1 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 67806-1-Ig targets PKMYT1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, HSC-T6 cells, 4T1 cells, NIH/3T3 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Protein kinase, membrane associated tyrosine/threonine (PKMYT1) is a member of the Wee family of protein kinases. PKMYT1 acts as a negative regulator of the cell cycle by inactivating the CDK1-cyclinB complex through phosphorylation of Tyr14/Tyr15 and preventing cell cycle entering into mitosis at the G2/M transition. In mammalian somatic cells, PKMYT1 affects the assembly of the Golgi apparatus and endoplasmic reticulum during telophase of mitosis by inhibiting cyclin activities. Abnormal expression of PKMYT1 is closely associated with multiple types of cancers. PKMYT1 protein was mainly localized in the cytoplasm. (PMID: 31695486, PMID: 32801781) Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30849 Product name: Recombinant human PKMYT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-180 aa of NM_004203 Sequence: MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRSLPPPPPAKGSIPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPSRPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEG Predict reactive species Full Name: protein kinase, membrane associated tyrosine/threonine 1 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: NM_004203 Gene Symbol: PKMYT1 Gene ID (NCBI): 9088 RRID: AB_2918569 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99640 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.