Iright
BRAND / VENDOR: Proteintech

Proteintech, 67808-1-Ig, SMCR7L/MID51 Monoclonal antibody

CATALOG NUMBER: 67808-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMCR7L/MID51 (67808-1-Ig) by Proteintech is a Monoclonal antibody targeting SMCR7L/MID51 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse , rat samples 67808-1-Ig targets SMCR7L/MID51 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse , rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells, HSC-T6 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Human SMCR7L gene encodes, MID51, the mitochondrial dynamic protein of 51 kDa (also called mitochondrial elongation factor 1, MIEF1). MID51 is a single-pass membrane protein anchored to the mitochondrial outer membrane and regulates mitochondrial morphology. Mitochondrial morphology is controlled by two opposing processes: fusion and fission. Elevated MID51 levels induce extensive mitochondrial fusion, whereas depletion of MID51 causes mitochondrial fragmentation. MID51 interacts with and recruits Drp1 to mitochondria, suggesting a critical role of MID51 in regulation of mitochondrial fusion-fission machinery in vertebrates. Specification Tested Reactivity: Human, mouse , rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13775 Product name: Recombinant human SMCR7L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-359 aa of BC002587 Sequence: FDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT Predict reactive species Full Name: Smith-Magenis syndrome chromosome region, candidate 7-like Calculated Molecular Weight: 463 aa, 51 kDa Observed Molecular Weight: 48-51 kDa GenBank Accession Number: BC002587 Gene Symbol: SMCR7L Gene ID (NCBI): 54471 RRID: AB_2918571 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NQG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924