Proteintech, 67824-1-Ig, C9orf72 Monoclonal antibody

Size: 20ul / 150ul The C9orf72 (67824-1-Ig) by Proteintech is a Monoclonal antibody targeting C9orf72 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 67824-1-Ig targets C9orf72 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig brain tissue, HEK-293 cells, U-87 MG cells, Neuro-2a cells, PC-12 cells, C6 cells, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse lung tissue, mouse intestine, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information C9ORF72 has a domain whith polymorphic hexanucleotide repeat (GGGGCC). The C9ORF72-hexanucleotide repeat expansions have been recently identified as genetic markers in amyotrophic lateral sclerosis (ALS) and frontotemporal lobar degeneration (FTLD). The C9ORF72 repeat expansions may indicate a worse prognosis in ALS. Human C9ORF72 has some isoforms with MW 54-60 kDa and 25-30 kDa. Mouse C9orf72 has some isoforms with MW 50-60 kDa and 35 kDa. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21080 Product name: Recombinant human C9orf72 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-169 aa of BC020851 Sequence: MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGEILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQG Predict reactive species Full Name: chromosome 9 open reading frame 72 Calculated Molecular Weight: 481 aa, 54 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC020851 Gene Symbol: C9orf72 Gene ID (NCBI): 203228 RRID: AB_2918586 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96LT7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.