Proteintech, 67829-1-Ig, TOE1 Monoclonal antibody

Size: 20ul / 150ul The TOE1 (67829-1-Ig) by Proteintech is a Monoclonal antibody targeting TOE1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 67829-1-Ig targets TOE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TOE1, also known as hCaf1z, belongs to the DEDD family of deadenylases. TOE1 was initially identified as a direct target gene of ERG1, an immediate early transcription factor. TOE1 encodes an Asp-Glu-Asp-Asp deadenylase that specifically localizes to Cajal bodies in the nucleus, where assembly and maturation of small nuclear ribonucleoprotein particles, and telomerase ribonucleoprotein complex take place (PMID: 36257135). TOE1 has 2 isoforms with the molecular mass of 48 and 57 kDa. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28982 Product name: Recombinant human TOE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-262 aa of BC009364 Sequence: MAADSDDGAVSAPAASDGGVSKSTTSGEELVVQVPVVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERYKAVCHAARTRSILSLGLACFKRQPDKGEHSYLAQVFNLTLLCMEEYVIEPKSVQFLIQHGFNFNQQYAQGIPYHKGNDKGDESQSQSVRTLFLELIRARRPLVLHNGLIDLVFLYQNFYAHLPESLGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCERENGKQRAAG Predict reactive species Full Name: target of EGR1, member 1 (nuclear) Calculated Molecular Weight: 510 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC009364 Gene Symbol: TOE1 Gene ID (NCBI): 114034 RRID: AB_2918591 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96GM8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.