Proteintech, 67832-1-Ig, PDE6A Monoclonal antibody

Size: 20ul / 150ul The PDE6A (67832-1-Ig) by Proteintech is a Monoclonal antibody targeting PDE6A in WB, ELISA applications with reactivity to human, mouse, rat samples 67832-1-Ig targets PDE6A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissue, mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information PDE6A(Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha) is also named as GMP-PDE alpha, PDE V-B1, PDEA and belongs to the cyclic nucleotide phosphodiesterase family. PDE6A contains an open reading frame capable of coding for a polypeptide of 859 amino acids and about 100 kDa. It is a subunit of a key phototransduction enzyme which participates in processes of transmission and amplification of the visual signal. The expression of PDE6 alpha in retina is essential for normal expression of PDE6 beta and PDE6 gama. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16741 Product name: Recombinant human PDE6A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-90 aa of BC035909 Sequence: MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVMKKLCFLLQ Predict reactive species Full Name: phosphodiesterase 6A, cGMP-specific, rod, alpha Calculated Molecular Weight: 860 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC035909 Gene Symbol: PDE6A Gene ID (NCBI): 5145 RRID: AB_2918594 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P16499 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.