Proteintech, 67854-1-Ig, EMCN Monoclonal antibody

Size: 20ul / 150ul The EMCN (67854-1-Ig) by Proteintech is a Monoclonal antibody targeting EMCN in WB, ELISA applications with reactivity to Human, Mouse samples 67854-1-Ig targets EMCN in WB, IF, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HUVEC cells, bEnd.3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: Human, Mouse Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31146 Product name: Recombinant human EMCN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-178 aa of BC017781 Sequence: MELLQVTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGTPENGNDQPQSDKESVKLLTVKTISHESGEHSAQGKTKN Predict reactive species Full Name: endomucin Calculated Molecular Weight: 19 kDa, 27 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC017781 Gene Symbol: EMCN Gene ID (NCBI): 51705 RRID: AB_2918612 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9ULC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.